PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN45524.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 253aa    MW: 29036.7 Da    PI: 8.9105
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN45524.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.78.5e-16956148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++ Ed ll  +v+q+G g+W++++ + g++R++k+c++rw++yl
       KHN45524.1  9 KGLWSEVEDTLLRTCVRQYGEGQWHLVPTRAGLNRCRKSCRLRWLNYL 56
                     678*******************************************97 PP

2Myb_DNA-binding47.25e-1562106147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg +T++E +l  +++++lG++ W++Ia +++ gRt++++k++w++y
       KHN45524.1  62 RGEFTEDEVDLMQRLHNLLGNR-WSLIAGRLP-GRTPNDVKNYWNTY 106
                      899*******************.*********.************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.496156IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.1E-20759IPR009057Homeodomain-like
SMARTSM007171.4E-13858IPR001005SANT/Myb domain
SuperFamilySSF466891.76E-268103IPR009057Homeodomain-like
PfamPF002491.2E-14956IPR001005SANT/Myb domain
CDDcd001671.92E-91256No hitNo description
PROSITE profilePS5129423.5957111IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.9E-2360111IPR009057Homeodomain-like
SMARTSM007172.7E-1461109IPR001005SANT/Myb domain
PfamPF002491.1E-1362106IPR001005SANT/Myb domain
CDDcd001671.45E-964107No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 253 aa     Download sequence    Send to blast
MDGSACVRKG LWSEVEDTLL RTCVRQYGEG QWHLVPTRAG LNRCRKSCRL RWLNYLKPNI  60
KRGEFTEDEV DLMQRLHNLL GNRWSLIAGR LPGRTPNDVK NYWNTYIRRK VSSSHKVVIN  120
EKQKKTTVKP HVVIKPKART FSRPSPSGLR GSSVLREEGG ESGAKHCSTH HQACAASSEY  180
INNWSTDQWW KTMMHDKGDN LDNNQCLLGY QDEVGKLVKD NNCDENLASL TTQEGEFLIE  240
GQNWSDFFLD TNL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-2431131110B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0902990.0BT090299.1 Soybean clone JCVI-FLGm-4K7 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003554899.10.0PREDICTED: transcription factor MYB114
SwissprotQ9FNV98e-54MY113_ARATH; Transcription factor MYB113
TrEMBLA0A0B2SM560.0A0A0B2SM56_GLYSO; Transcription factor MYB113
TrEMBLK7MW480.0K7MW48_SOYBN; Uncharacterized protein
STRINGGLYMA19G02980.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66370.12e-54myb domain protein 113
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]